(data stored in ACNUC7421 zone)

EMBL: CP000947.PE237

CP000947.PE237       Location/Qualifiers
FT   CDS             complement(256736..257500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0241"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   hit:NTHI1495 modification methylase DpnIIB-like"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31867"
FT                   /db_xref="GOA:B0UW46"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW46"
FT                   /protein_id="ACA31867.1"
FT                   /translation="MEHIKRTQKCELFNDHFQNYKRYHIPKAQLVIADIPYNVGNNAYA
FT                   SSPEWYKDGDNKNGESDKANKAFFDTDENFRIAEFMHFCSKMLVKEPKERNQAPCMIVF
FT                   CAFQQIQMVLEYAEKYGFKKHIPLVFIKSSSPQVLKANMKVVGATEYALILYREKLPKF
FT                   RNNGKMIKNWMEWTRDDRKKYPKLHPTQKPIDVLKRLIEIFTDEGDVVIDPVAGSGSTL
FT                   RAARELGRNSYGFEIKKDVYQNAKENMLKEGD"
     MEHIKRTQKC ELFNDHFQNY KRYHIPKAQL VIADIPYNVG NNAYASSPEW YKDGDNKNGE        60
     SDKANKAFFD TDENFRIAEF MHFCSKMLVK EPKERNQAPC MIVFCAFQQI QMVLEYAEKY       120
     GFKKHIPLVF IKSSSPQVLK ANMKVVGATE YALILYREKL PKFRNNGKMI KNWMEWTRDD       180
     RKKYPKLHPT QKPIDVLKRL IEIFTDEGDV VIDPVAGSGS TLRAARELGR NSYGFEIKKD       240
     VYQNAKENML KEGD                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page