(data stored in ACNUC7421 zone)

EMBL: CP000947.PE238

CP000947.PE238       Location/Qualifiers
FT   CDS             complement(257511..257972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmu:PM1778 unknown"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31868"
FT                   /db_xref="InterPro:IPR018880"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW47"
FT                   /protein_id="ACA31868.1"
FT                   /translation="MNMHLKKTSAEPQNSNVRQTANSSTPLNRAFFIRTLRTSQINPFA
FT                   YGAKCLISMVAYHGKGFALCCVPFDAVSELMIRCRQYQSLRTLRAVTPKNTNGVTLMIY
FT                   KFILLGKNRLHLSIFANNEQQARNRVNLSNAICYARINPKQYRTLSGNA"
     MNMHLKKTSA EPQNSNVRQT ANSSTPLNRA FFIRTLRTSQ INPFAYGAKC LISMVAYHGK        60
     GFALCCVPFD AVSELMIRCR QYQSLRTLRA VTPKNTNGVT LMIYKFILLG KNRLHLSIFA       120
     NNEQQARNRV NLSNAICYAR INPKQYRTLS GNA                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page