(data stored in ACNUC7421 zone)

EMBL: CP000947.PE241

CP000947.PE241       Location/Qualifiers
FT   CDS             259257..259694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vei:Veis_1323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31871"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW50"
FT                   /protein_id="ACA31871.1"
FT                   /translation="MAYSAMQVANAFIQKAQEGKVPALTPMKLQKLMFFAQSWYLKKYH
FT                   VRLIDDHFVRWQYGPVIPSVYYEFSSFGSCDINQPATNPFGIIAPNLTIADDAFIDEVI
FT                   ATYGSFDGWKLSVMTHQPKTAWSMGKIGSVITPIEMFEGKV"
     MAYSAMQVAN AFIQKAQEGK VPALTPMKLQ KLMFFAQSWY LKKYHVRLID DHFVRWQYGP        60
     VIPSVYYEFS SFGSCDINQP ATNPFGIIAP NLTIADDAFI DEVIATYGSF DGWKLSVMTH       120
     QPKTAWSMGK IGSVITPIEM FEGKV                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page