(data stored in ACNUC7421 zone)

EMBL: CP000947.PE243

CP000947.PE243       Location/Qualifiers
FT   CDS             complement(262158..262610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nma:NMA1837 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31873"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW52"
FT                   /protein_id="ACA31873.1"
FT                   /translation="MQEVEVISTALNFCHEFGLTKKSRKKCEKVFQQIEERSNFIINLS
FT                   IKSDEEWKETTGNLTRGHFDPSTFTITIPESIYELACRGDRTSLFIIFHEFGHLFLGHR
FT                   AVLHNAKVPPTKNEDAEWQADTFAEIVLERLGFYTSPQLELDFGGM"
     MQEVEVISTA LNFCHEFGLT KKSRKKCEKV FQQIEERSNF IINLSIKSDE EWKETTGNLT        60
     RGHFDPSTFT ITIPESIYEL ACRGDRTSLF IIFHEFGHLF LGHRAVLHNA KVPPTKNEDA       120
     EWQADTFAEI VLERLGFYTS PQLELDFGGM                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page