(data stored in ACNUC7421 zone)

EMBL: CP000947.PE244

CP000947.PE244       Location/Qualifiers
FT   CDS             complement(262646..263011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0248"
FT                   /product="conserved hypothetical DNA-binding protein"
FT                   /note="KEGG: nma:NMA1838 hypothetical DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31874"
FT                   /db_xref="GOA:B0UW53"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW53"
FT                   /protein_id="ACA31874.1"
FT                   /translation="MALTEFGKIVRKARIDANETLLTMSKALGTTPAYLSGLETGSKKI
FT                   SKKWVVAITHFFKEKGIEVKELQKLADVSNENVPIDGLSEHHKMLVAGFANSRYTAKEL
FT                   AQISELLTRINHEKDSK"
     MALTEFGKIV RKARIDANET LLTMSKALGT TPAYLSGLET GSKKISKKWV VAITHFFKEK        60
     GIEVKELQKL ADVSNENVPI DGLSEHHKML VAGFANSRYT AKELAQISEL LTRINHEKDS       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page