(data stored in ACNUC7421 zone)

EMBL: CP000947.PE245

CP000947.PE245       Location/Qualifiers
FT   CDS             263373..263696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0249"
FT                   /product="Addiction module killer protein HI1419"
FT                   /note="TIGRFAM: Addiction module killer protein HI1419;
FT                   PFAM: protein of unknown function DUF891; KEGG:
FT                   bxe:Bxe_B0862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31875"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW54"
FT                   /protein_id="ACA31875.1"
FT                   /translation="MYSIKQTSIFKQWLKNIKDPIARIMVIKRIERAKNGNFGDHKLLA
FT                   NTGGIYEMRIDTGKGYRIYYAKIEDIIYLLTNGGDKKTQQQDISDAQVILEKFKQLGDD
FT                   ENE"
     MYSIKQTSIF KQWLKNIKDP IARIMVIKRI ERAKNGNFGD HKLLANTGGI YEMRIDTGKG        60
     YRIYYAKIED IIYLLTNGGD KKTQQQDISD AQVILEKFKQ LGDDENE                     107
//

If you have problems or comments...

PBIL Back to PBIL home page