(data stored in ACNUC7421 zone)

EMBL: CP000947.PE246

CP000947.PE246       Location/Qualifiers
FT   CDS             263689..263988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0250"
FT                   /product="putative transcriptional regulator"
FT                   /note="TIGRFAM: Addiction module antidote protein HI1420;
FT                   KEGG: pfo:Pfl_2007 predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31877"
FT                   /db_xref="GOA:B0UW55"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW55"
FT                   /protein_id="ACA31877.1"
FT                   /translation="MSEQNNIEVTDFDAAEFLENDELIALYLAETLKNGNDEEFIQALN
FT                   TVARAKGMNDIAKKAGIARESLYQTLSSNKPRFETVRKILNALNIDLIPTVKTA"
     MSEQNNIEVT DFDAAEFLEN DELIALYLAE TLKNGNDEEF IQALNTVARA KGMNDIAKKA        60
     GIARESLYQT LSSNKPRFET VRKILNALNI DLIPTVKTA                               99
//

If you have problems or comments...

PBIL Back to PBIL home page