(data stored in ACNUC7421 zone)

EMBL: CP000947.PE248

CP000947.PE248       Location/Qualifiers
FT   CDS             265555..266385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0252"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: hso:HS_1363
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31879"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW57"
FT                   /protein_id="ACA31879.1"
FT                   /translation="MRAVSIVGLGWLGLTLARHLKNLGWKVKGTKRTHEGVEQMRLIRL
FT                   EAYHLELTPDINADPDDLTALLSVDALVINIPPSQYFFHLQHYVQGVKNLVNEALLNGL
FT                   QHIIFISSTSVFPDVSGEFDEQSQIVPQSEMSKALLEIEQWLFELKDVDCDIIRFGGLV
FT                   GEDRHPVYSLAGKDELSAGNMPINLVHVDDCARAIQLLLETPSSQRLYHLVAPQHPTRA
FT                   EYYSQIAEKLALEAPHFICSEQDPRRVILANKICRELSFVYQCPDPYLMLFERK"
     MRAVSIVGLG WLGLTLARHL KNLGWKVKGT KRTHEGVEQM RLIRLEAYHL ELTPDINADP        60
     DDLTALLSVD ALVINIPPSQ YFFHLQHYVQ GVKNLVNEAL LNGLQHIIFI SSTSVFPDVS       120
     GEFDEQSQIV PQSEMSKALL EIEQWLFELK DVDCDIIRFG GLVGEDRHPV YSLAGKDELS       180
     AGNMPINLVH VDDCARAIQL LLETPSSQRL YHLVAPQHPT RAEYYSQIAE KLALEAPHFI       240
     CSEQDPRRVI LANKICRELS FVYQCPDPYL MLFERK                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page