(data stored in ACNUC7421 zone)

EMBL: CP000947.PE250

CP000947.PE250       Location/Qualifiers
FT   CDS             267923..268810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0254"
FT                   /product="protein of unknown function DUF535"
FT                   /note="PFAM: protein of unknown function DUF535; KEGG:
FT                   hso:HS_1361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31881"
FT                   /db_xref="InterPro:IPR007488"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW59"
FT                   /protein_id="ACA31881.1"
FT                   /translation="MKNLFSFPSFYQFSNERRFLKRLRTRIRYYFYRLTCFKECQIFVT
FT                   YLNHNPLWIDIFTKSYYRCDAVLRKYCDNRFNKKQRVQAIMDNFSVAEQVFGRSFSQLL
FT                   VEKDKVLLAELTDELDLYLAINQIDPFEGFFAVNIRNKQGQRIYDASFSFLAGNKLLIT
FT                   SVQGPSDDNSQELIKSTTKQLHGVRPMFMLVNVYKLLAKELNCELLGIAHKNQGKYRWN
FT                   DNARLLFNYDDFWQENNALLNPQGYWQLPVVIERKTLEDIQSKKRSMYRKRYEMFDFIE
FT                   KNITEIFGKENLNK"
     MKNLFSFPSF YQFSNERRFL KRLRTRIRYY FYRLTCFKEC QIFVTYLNHN PLWIDIFTKS        60
     YYRCDAVLRK YCDNRFNKKQ RVQAIMDNFS VAEQVFGRSF SQLLVEKDKV LLAELTDELD       120
     LYLAINQIDP FEGFFAVNIR NKQGQRIYDA SFSFLAGNKL LITSVQGPSD DNSQELIKST       180
     TKQLHGVRPM FMLVNVYKLL AKELNCELLG IAHKNQGKYR WNDNARLLFN YDDFWQENNA       240
     LLNPQGYWQL PVVIERKTLE DIQSKKRSMY RKRYEMFDFI EKNITEIFGK ENLNK            295
//

If you have problems or comments...

PBIL Back to PBIL home page