(data stored in ACNUC7421 zone)

EMBL: CP000947.PE251

CP000947.PE251       Location/Qualifiers
FT   CDS             268893..269348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0255"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /note="TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ; PFAM:
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ; KEGG: hso:HS_1360 3-hydroxymyristoyl-(acyl
FT                   carrier protein) dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31882"
FT                   /db_xref="GOA:B0UW60"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW60"
FT                   /protein_id="ACA31882.1"
FT                   /translation="MTVTTERIARIIESKEIMTLLPHRYPFLLVDRVTDYEEGKWLTAI
FT                   KNVSVNEPCFTGHFPDQPILPGVLILEALAQAMGILAFKTHELSNKELFYFAGVDEARF
FT                   KRPILPGDQMMLKVEVIRERRGITAFTGVASVNGEVACEAKLMCARR"
     MTVTTERIAR IIESKEIMTL LPHRYPFLLV DRVTDYEEGK WLTAIKNVSV NEPCFTGHFP        60
     DQPILPGVLI LEALAQAMGI LAFKTHELSN KELFYFAGVD EARFKRPILP GDQMMLKVEV       120
     IRERRGITAF TGVASVNGEV ACEAKLMCAR R                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page