(data stored in ACNUC7421 zone)

EMBL: CP000947.PE252

CP000947.PE252       Location/Qualifiers
FT   CDS             269362..270150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0256"
FT                   /product="acyl-(acyl-carrier-protein)--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="TIGRFAM:
FT                   acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase; KEGG: hso:HS_1359
FT                   UDP-N-acetylglucosamine acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31883"
FT                   /db_xref="GOA:B0UW61"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW61"
FT                   /protein_id="ACA31883.1"
FT                   /translation="MIHSTAKIHPSSIIEEGAKIGENVVIGPFCIVGSDVQIGKGTTLH
FT                   SHVVVKGVTTIGEDNQIFQFASIGEVNQDLKYQGEPTKTIIGHRNRIRESVTIHRGTVQ
FT                   GGGVTRIGDDNLLMINAHIAHDCQIGNRCILANNATLAGHVELGDFVIVGGMSAIHQFV
FT                   IVGAHVMLGGGSMVSQDVPPYVMAQGNHARPFGVNIEGLKRRGFDKPTLHAIRNVYKLI
FT                   YRSGKTLEEVIPEIENYAQTESAVSFFLDFFTRSTRGIIR"
     MIHSTAKIHP SSIIEEGAKI GENVVIGPFC IVGSDVQIGK GTTLHSHVVV KGVTTIGEDN        60
     QIFQFASIGE VNQDLKYQGE PTKTIIGHRN RIRESVTIHR GTVQGGGVTR IGDDNLLMIN       120
     AHIAHDCQIG NRCILANNAT LAGHVELGDF VIVGGMSAIH QFVIVGAHVM LGGGSMVSQD       180
     VPPYVMAQGN HARPFGVNIE GLKRRGFDKP TLHAIRNVYK LIYRSGKTLE EVIPEIENYA       240
     QTESAVSFFL DFFTRSTRGI IR                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page