(data stored in ACNUC7421 zone)

EMBL: CP000947.PE255

CP000947.PE255       Location/Qualifiers
FT   CDS             272098..272682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0259"
FT                   /product="molybdenum cofactor synthesis domain"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; KEGG: hso:HS_1356
FT                   molybdopterin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31886"
FT                   /db_xref="GOA:B0UW64"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW64"
FT                   /protein_id="ACA31886.1"
FT                   /translation="MATLLKIGLVSVSDRASQGVYQDQGIPELLEWLKSALCDPFEVES
FT                   RLIPDEQTLIEKTLCELVDDCHCHLVLTTGGTGPVKRDVTPDATLAVADREMPGFGEQM
FT                   RQVSLHFVPTAILSRQVGVIRRNSLILNLPGQPKAIKETLEGVKDEHGNVIVKGIFSAV
FT                   PYCLQLIDGIYIDTDPNVIESFRPKSARRTL"
     MATLLKIGLV SVSDRASQGV YQDQGIPELL EWLKSALCDP FEVESRLIPD EQTLIEKTLC        60
     ELVDDCHCHL VLTTGGTGPV KRDVTPDATL AVADREMPGF GEQMRQVSLH FVPTAILSRQ       120
     VGVIRRNSLI LNLPGQPKAI KETLEGVKDE HGNVIVKGIF SAVPYCLQLI DGIYIDTDPN       180
     VIESFRPKSA RRTL                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page