(data stored in ACNUC7421 zone)

EMBL: CP000947.PE256

CP000947.PE256       Location/Qualifiers
FT   CDS             272725..273063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0260"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   hso:HS_1355 nitrogen regulatory protein p-II"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31888"
FT                   /db_xref="GOA:B0UW65"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW65"
FT                   /protein_id="ACA31888.1"
FT                   /translation="MKKIEAIIKPFKLDDVRESLADIGITGMTVTEVRGFGRQKGHTEL
FT                   YRGAEYMVDFLPKVKMEIIVPDEIVEQCIEAIIETAQTGKIGDGKIFVYDVNRVIRIRT
FT                   REENEEAL"
     MKKIEAIIKP FKLDDVRESL ADIGITGMTV TEVRGFGRQK GHTELYRGAE YMVDFLPKVK        60
     MEIIVPDEIV EQCIEAIIET AQTGKIGDGK IFVYDVNRVI RIRTREENEE AL               112
//

If you have problems or comments...

PBIL Back to PBIL home page