(data stored in ACNUC7421 zone)

EMBL: CP000947.PE257

CP000947.PE257       Location/Qualifiers
FT   CDS             273063..274115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0261"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   hso:HS_1354 possible permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31889"
FT                   /db_xref="GOA:B0UW66"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW66"
FT                   /protein_id="ACA31889.1"
FT                   /translation="MSERNSSLTQVLVACAAIIVILGGIKLASEIVVPFLLSLFIAIIC
FT                   SPVVNFMTKRKIPHWLAITLLFVLIVVLFYFLASLISNTVQEFTQSIPQYKVLLSQRLN
FT                   DLLAFAHHFNIPLFFSTDSINDDFDPSIIMKFVSRFLLSFSNVVTNIFVLFLIVVFMLA
FT                   EAPTVKQKFTKLIVTENTVTQQNYIERILQGVIGYLGVKTITSVMTGLCIYFVLSVLDI
FT                   QYAILWATLVFLLNYIPNIGSIIAAVPVIVQSFLLNGFITGLVVSIAFILINTVVGNVL
FT                   EPKMMGRKLGLSTLIVFLSLLFWGWLLGTVGMLLSVPLTMGLKIALEANPNTIKYAELL
FT                   GDVSDVQNVK"
     MSERNSSLTQ VLVACAAIIV ILGGIKLASE IVVPFLLSLF IAIICSPVVN FMTKRKIPHW        60
     LAITLLFVLI VVLFYFLASL ISNTVQEFTQ SIPQYKVLLS QRLNDLLAFA HHFNIPLFFS       120
     TDSINDDFDP SIIMKFVSRF LLSFSNVVTN IFVLFLIVVF MLAEAPTVKQ KFTKLIVTEN       180
     TVTQQNYIER ILQGVIGYLG VKTITSVMTG LCIYFVLSVL DIQYAILWAT LVFLLNYIPN       240
     IGSIIAAVPV IVQSFLLNGF ITGLVVSIAF ILINTVVGNV LEPKMMGRKL GLSTLIVFLS       300
     LLFWGWLLGT VGMLLSVPLT MGLKIALEAN PNTIKYAELL GDVSDVQNVK                  350
//

If you have problems or comments...

PBIL Back to PBIL home page