(data stored in ACNUC7421 zone)

EMBL: CP000947.PE258

CP000947.PE258       Location/Qualifiers
FT   CDS             complement(274430..275383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0262"
FT                   /product="modification methylase, HemK family"
FT                   /EC_number="2.1.1.72"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   putative RNA methylase; methyltransferase small; KEGG:
FT                   hso:HS_1353 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31890"
FT                   /db_xref="GOA:B0UW67"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017127"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW67"
FT                   /protein_id="ACA31890.1"
FT                   /translation="MSTINQFNQELVDCILTDQVQNSLHTIQDFLRWTYSIFNRSDIYY
FT                   GHGYDNAWDESLQLILTGLHLPLDFPEKLYNSALTTSEKNSLIQLVIARIEQRLPIAYL
FT                   TNSAWFCGLEFYVDERVIIPRSPISALITNKFKGLLQQDPIRILDLCTGSGCIAIACAE
FT                   QFTHAEVDAVDLSIDALNVAEINIERHNLTHRVFPIQSDLFKNLPLDQYDLIITNPPYV
FT                   DEEDLQDMPIEFHHEPEMALGSGIDGLTITKEILANSADYLTDNGILICEVGNSMVHLI
FT                   EQFPEVPFQWLELRNGGIGVFALHKKDLVKYKKKFL"
     MSTINQFNQE LVDCILTDQV QNSLHTIQDF LRWTYSIFNR SDIYYGHGYD NAWDESLQLI        60
     LTGLHLPLDF PEKLYNSALT TSEKNSLIQL VIARIEQRLP IAYLTNSAWF CGLEFYVDER       120
     VIIPRSPISA LITNKFKGLL QQDPIRILDL CTGSGCIAIA CAEQFTHAEV DAVDLSIDAL       180
     NVAEINIERH NLTHRVFPIQ SDLFKNLPLD QYDLIITNPP YVDEEDLQDM PIEFHHEPEM       240
     ALGSGIDGLT ITKEILANSA DYLTDNGILI CEVGNSMVHL IEQFPEVPFQ WLELRNGGIG       300
     VFALHKKDLV KYKKKFL                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page