(data stored in ACNUC7421 zone)

EMBL: CP000947.PE259

CP000947.PE259       Location/Qualifiers
FT   CDS             275468..275974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0263"
FT                   /product="Smr protein/MutS2"
FT                   /note="PFAM: Smr protein/MutS2; KEGG: hso:HS_1352
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31891"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR022990"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW68"
FT                   /protein_id="ACA31891.1"
FT                   /translation="MLNDEDIELFHREIQGAKKIEQNIFIAPRHRNLKNKVEIRNVREK
FT                   EDTLFFFSDEYEPLLNEDGTVKYLRPHEDRYLLKQLRRGDFSPELFLDLHGLTRKEAKI
FT                   ELASLIHACEKEHVYCACIMTGYGTYTLKQQIPRWLVQHPRVRALHQAPREWGGDAAIL
FT                   VLLDV"
     MLNDEDIELF HREIQGAKKI EQNIFIAPRH RNLKNKVEIR NVREKEDTLF FFSDEYEPLL        60
     NEDGTVKYLR PHEDRYLLKQ LRRGDFSPEL FLDLHGLTRK EAKIELASLI HACEKEHVYC       120
     ACIMTGYGTY TLKQQIPRWL VQHPRVRALH QAPREWGGDA AILVLLDV                    168
//

If you have problems or comments...

PBIL Back to PBIL home page