(data stored in ACNUC7421 zone)

EMBL: CP000947.PE26

CP000947.PE26        Location/Qualifiers
FT   CDS             21934..22356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0026"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: hso:HS_0160
FT                   thiosulfate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31887"
FT                   /db_xref="GOA:B0UUY4"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY4"
FT                   /protein_id="ACA31887.1"
FT                   /translation="MYFTVKSFLEKVSLPYKETVLYCEILLLLNYHKMTTFKEINSEQA
FT                   WEILNNKNAVLVDIRDLSHFIYSRPKSAFHLTHQRFSEFQQKYEYDQPIIVSCYHGVSS
FT                   RNVAQFLVEQGYDEVYSLIGGFAGWVQANLPVESGY"
     MYFTVKSFLE KVSLPYKETV LYCEILLLLN YHKMTTFKEI NSEQAWEILN NKNAVLVDIR        60
     DLSHFIYSRP KSAFHLTHQR FSEFQQKYEY DQPIIVSCYH GVSSRNVAQF LVEQGYDEVY       120
     SLIGGFAGWV QANLPVESGY                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page