(data stored in ACNUC7421 zone)

EMBL: CP000947.PE260

CP000947.PE260       Location/Qualifiers
FT   CDS             complement(275976..278141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0264"
FT                   /product="hypothetical membrane protein"
FT                   /note="TIGRFAM: hypothetical membrane protein; integral
FT                   membrane protein, YccS/YhfK family; PFAM: protein of
FT                   unknown function DUF893 YccS/YhfK; KEGG: hso:HS_1351
FT                   possible membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31892"
FT                   /db_xref="GOA:B0UW69"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW69"
FT                   /protein_id="ACA31892.1"
FT                   /translation="MTPWINTKIILSIPVFLAVNIVTFSIWKLNISEQSMPLILGIIAG
FT                   GLVDLDNRLTGRLKYVFYTLIAFSISSLSVQLTLGHGIEYLLLMTALTFLFTMVGAIGQ
FT                   SYSTIAFGTLVVALYTTLTYTPNVSWYINPILILCGTLLYSLCTVFVHLMFQNRPVQEN
FT                   MTKAFLALSEYLDTKSLFFDPDDIEQLENKRVILAMKNGNLITAFNACRTALFHRIRGQ
FT                   HKHRRTTKMIKYYFAAQDIHERINSSHFNYQQLSEQLKNTDLIFRIQRLLELQAQSCRE
FT                   IAHSLQYNKSYSYNPRLEQAILGINQSFEIHYQNSHLNQLQRLAIKTLIDNLQAVNWQL
FT                   HHMDQYSENTNERSEGTQIYTEQIIGLKNMWRTICSHFTFESQLFRHAIRLSIIVFVSC
FT                   SLVEIFNLQLGYWILLTAVFVCQPNYSATKLRLKQRIIGTILGVVIGSLLPYIHPTLEL
FT                   QLGLVVVTSTLFFFFRSNNYSYSTFFITLQVLISFNIMGFDLNNALLSRLTDTLIGSFI
FT                   AWSAVSYLWPDWKYLQLNKVIKQAIKANAKYFLYIISQLLFGKGDPLKYRIARRQAHEY
FT                   ATALSTTLSNMNSEPKKYQAYLQEGFELVKINYSLLSYISALGAYRKNMQKIQQSAVFL
FT                   GEFYPIAKKLLHVLEHIETLERDNFEKLLLNIEFSLKQFSDEHADQFNRNEVAIPLQQL
FT                   NLINQILPALYTAFRQNQRTSKLDANK"
     MTPWINTKII LSIPVFLAVN IVTFSIWKLN ISEQSMPLIL GIIAGGLVDL DNRLTGRLKY        60
     VFYTLIAFSI SSLSVQLTLG HGIEYLLLMT ALTFLFTMVG AIGQSYSTIA FGTLVVALYT       120
     TLTYTPNVSW YINPILILCG TLLYSLCTVF VHLMFQNRPV QENMTKAFLA LSEYLDTKSL       180
     FFDPDDIEQL ENKRVILAMK NGNLITAFNA CRTALFHRIR GQHKHRRTTK MIKYYFAAQD       240
     IHERINSSHF NYQQLSEQLK NTDLIFRIQR LLELQAQSCR EIAHSLQYNK SYSYNPRLEQ       300
     AILGINQSFE IHYQNSHLNQ LQRLAIKTLI DNLQAVNWQL HHMDQYSENT NERSEGTQIY       360
     TEQIIGLKNM WRTICSHFTF ESQLFRHAIR LSIIVFVSCS LVEIFNLQLG YWILLTAVFV       420
     CQPNYSATKL RLKQRIIGTI LGVVIGSLLP YIHPTLELQL GLVVVTSTLF FFFRSNNYSY       480
     STFFITLQVL ISFNIMGFDL NNALLSRLTD TLIGSFIAWS AVSYLWPDWK YLQLNKVIKQ       540
     AIKANAKYFL YIISQLLFGK GDPLKYRIAR RQAHEYATAL STTLSNMNSE PKKYQAYLQE       600
     GFELVKINYS LLSYISALGA YRKNMQKIQQ SAVFLGEFYP IAKKLLHVLE HIETLERDNF       660
     EKLLLNIEFS LKQFSDEHAD QFNRNEVAIP LQQLNLINQI LPALYTAFRQ NQRTSKLDAN       720
     K                                                                       721
//

If you have problems or comments...

PBIL Back to PBIL home page