(data stored in ACNUC7421 zone)

EMBL: CP000947.PE261

CP000947.PE261       Location/Qualifiers
FT   CDS             complement(278166..278624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0265"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="TIGRFAM: methylglyoxal synthase; PFAM: MGS domain
FT                   protein; KEGG: hso:HS_1350 methylglyoxal synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31893"
FT                   /db_xref="GOA:B0UW70"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW70"
FT                   /protein_id="ACA31893.1"
FT                   /translation="MQTTYRKLAKNKKIALVAHDHCKQDLIQWCQTNRTLLQPHILYAT
FT                   GTTGNLIHQETNLEIKNLLSGPMGGDQQLGGLIAEGKIDLLIFFWDPMNAVPHDPDVKA
FT                   LMRIATVWNIPVAMNIATADFLISSPAFQQETEIRIPDYQGYLKERLK"
     MQTTYRKLAK NKKIALVAHD HCKQDLIQWC QTNRTLLQPH ILYATGTTGN LIHQETNLEI        60
     KNLLSGPMGG DQQLGGLIAE GKIDLLIFFW DPMNAVPHDP DVKALMRIAT VWNIPVAMNI       120
     ATADFLISSP AFQQETEIRI PDYQGYLKER LK                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page