(data stored in ACNUC7421 zone)

EMBL: CP000947.PE262

CP000947.PE262       Location/Qualifiers
FT   CDS             complement(278689..279342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_1349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31894"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW71"
FT                   /protein_id="ACA31894.1"
FT                   /translation="MKFSFAALASAMLLTSTAAFAGIVTSSSNIDFLAIDGQKANKDLL
FT                   KSTKSFNINESQTHQVVVRVSEIVRHGSDRSLYESDPIVVTFQGTNEDVVISAPKLENE
FT                   RDIKNFKDSPSVIVKTNSGKIIATKQEILKQEGFLPGANLIDTLSEYNASGSVASVSNF
FT                   ATAMPAVALGFAKAQKGKVVVQGENIAEQQLQFWFQQADKETQARFINWAKNQK"
     MKFSFAALAS AMLLTSTAAF AGIVTSSSNI DFLAIDGQKA NKDLLKSTKS FNINESQTHQ        60
     VVVRVSEIVR HGSDRSLYES DPIVVTFQGT NEDVVISAPK LENERDIKNF KDSPSVIVKT       120
     NSGKIIATKQ EILKQEGFLP GANLIDTLSE YNASGSVASV SNFATAMPAV ALGFAKAQKG       180
     KVVVQGENIA EQQLQFWFQQ ADKETQARFI NWAKNQK                                217
//

If you have problems or comments...

PBIL Back to PBIL home page