(data stored in ACNUC7421 zone)

EMBL: CP000947.PE263

CP000947.PE263       Location/Qualifiers
FT   CDS             279733..281478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0267"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Hemolysin activator HlyB domain protein;
FT                   Polypeptide-transport-associated domain protein ShlB-type;
FT                   KEGG: msu:MS1169 FhaC protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31895"
FT                   /db_xref="GOA:B0UW72"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW72"
FT                   /protein_id="ACA31895.1"
FT                   /translation="MKKMSVLIWLCGFSSLLSAVERPLLQLNRIDAQQQQRQKEQIQQQ
FT                   SERLRSDPDVRMEISSEKPTALPFNESPCYPIQHLSIVDYSSDNKTKPSQFQWALNKAV
FT                   TQLNLQLPHCFGTQGLGILMKQVQNNVIERGYITTRVVAGEQNLTQGVFSLTVIPGQVR
FT                   HTIIADVSSLPWFSKLTAKTALAFKQGDLVNIRDIEQSLENLKRVPTADANIDILPADN
FT                   SSAFGESDIKITYQQRFPFRFSLNLDDSGSTSTGKWQGSATLSWDNLFSANDLFYTTFT
FT                   HSLKRHSDNSGRRATRNYGFYYSVPLGYWALSASLYKTDYHQDVFGAFDNTYLYAGRSE
FT                   TTNLNLAYRLYRDAVRKTTISGGFWSRHSKNYIDDAEIDVQRRRMAGWQLNLSHIEYIK
FT                   AVTLKLSLGFKWGTGVGRTIAAPEEYWGNGTSRPKIITASVDINYPFYMGKQPLAFNTT
FT                   WSTQWNKTPLIQQDRLSIGGRYTVRGFDGELTLSGERGWLWRNELSWNIANKGHWVYLA
FT                   LDGGRVMGRSDGIRLGHHLMGTVLGLRGSWTHFYYDVFIGRPLSKPSGFRTSHTVTGFN
FT                   IGLTF"
     MKKMSVLIWL CGFSSLLSAV ERPLLQLNRI DAQQQQRQKE QIQQQSERLR SDPDVRMEIS        60
     SEKPTALPFN ESPCYPIQHL SIVDYSSDNK TKPSQFQWAL NKAVTQLNLQ LPHCFGTQGL       120
     GILMKQVQNN VIERGYITTR VVAGEQNLTQ GVFSLTVIPG QVRHTIIADV SSLPWFSKLT       180
     AKTALAFKQG DLVNIRDIEQ SLENLKRVPT ADANIDILPA DNSSAFGESD IKITYQQRFP       240
     FRFSLNLDDS GSTSTGKWQG SATLSWDNLF SANDLFYTTF THSLKRHSDN SGRRATRNYG       300
     FYYSVPLGYW ALSASLYKTD YHQDVFGAFD NTYLYAGRSE TTNLNLAYRL YRDAVRKTTI       360
     SGGFWSRHSK NYIDDAEIDV QRRRMAGWQL NLSHIEYIKA VTLKLSLGFK WGTGVGRTIA       420
     APEEYWGNGT SRPKIITASV DINYPFYMGK QPLAFNTTWS TQWNKTPLIQ QDRLSIGGRY       480
     TVRGFDGELT LSGERGWLWR NELSWNIANK GHWVYLALDG GRVMGRSDGI RLGHHLMGTV       540
     LGLRGSWTHF YYDVFIGRPL SKPSGFRTSH TVTGFNIGLT F                           581
//

If you have problems or comments...

PBIL Back to PBIL home page