(data stored in ACNUC7421 zone)

EMBL: CP000947.PE264

CP000947.PE264       Location/Qualifiers
FT   CDS             281512..288630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0268"
FT                   /product="filamentous haemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; adhesin HecA family; PFAM: Haemagluttinin
FT                   repeat-containing protein; filamentous haemagglutinin
FT                   domain protein; KEGG: nme:NMB1768
FT                   hemagglutinin/hemolysin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31896"
FT                   /db_xref="GOA:B0UW73"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW73"
FT                   /protein_id="ACA31896.1"
FT                   /translation="MNKRQFRVIFSKTLQPIVVVSEPVKTEGKTKSEMPQMQSAVNFLP
FT                   IFAALTPLVFRLFCALSFVFSSSVFAETLIIKADPNAPKNQQPIVLQTANGLPQVNIQT
FT                   PNDKGLSHNKYQDFNVDKKGAILNNSHKDTQTQQAGWVQSNPYLARGEAKVILNEVTST
FT                   HPTQLKGYVEVAGRKAEVIIANPNGLHCDGCGTINATRSTMTTGKPQIIDGQVESINIE
FT                   RGKITISGKGLDNSRVNYTDILAREAEINAGVWAGKKLNVVTGKNTIKQADMEHGGNDL
FT                   QITHIDSQNLSENAPHFALDVSELGGMYAGKIHLVGTEQGLGVRNAGHIGASADNLVID
FT                   SQGKIVNQGMISAKGNLHVSTKKEIQNQGQLLTEAQLSTKSSHLDNRGGKIEGRTAQIN
FT                   ATETVNNDRIGSTGSLIQTAEKLDIHSKLVTNKNTKASQSKPPEQGIIAGVLTINGDAL
FT                   ANQNGAIYGMQNVQLNLSVHLDNQQGEILSLGELQIQGDKLNMNNEHGEIASRSNLAIY
FT                   ANKLESEGEIESSHNASIHLKQDLTLNNAFKVGGNLDFQTQGNFINNSVLRVGEKLSIQ
FT                   AHNINNNRESELSGKNTQILSNEIINRGLIDGEKTLLKSTALSNLGTGRIYGNHLAIAT
FT                   PNLINGKEDNASPTIAARERLDLAVGSLINRDHALIFSAGEMGIGGHLNEQHHAEGKAS
FT                   FIDNGSATIEALGNAYVNTARLQNHDLHLRLGENHTDERRVEYAPKNTSRRYVLIDKDG
FT                   NHGRFDSRNNSRSDRNSYLRLNDGTTIAANSWMHWDYNRHTITTTIEKRDPAKILIGGD
FT                   LHLSGNDLENNASTLSVGKRLLLGDEVFIKNDKNETLHSTTGTSLNNIDIAGTINVTDK
FT                   GHWDSFHKKKRRYGIRGRKRWAVYGTGRGDLNDIHPTSHFFFNKVDNTIGQPVDSTNTQ
FT                   ITAQAEAIVPNQMNGVIINLPEQSLYQINPDAPNGYLVETDPHFTNRKQWLSSDYMLNA
FT                   LRYNHENVQKRLGDGFYEQRLINEQIHQLTGRRFLDNHQTDDEQYKALMDSGIYYAKKF
FT                   NLHLGVGLTAEQMAELTADMVWFVNKEITLPSGKKLTVLTPQVYLVARNLDVTSQGALI
FT                   SAREIMGNINGKLTNTGTIAGRNLTALSAKNINNQGLVLGDSVNLLAKQKLVNLGGRIE
FT                   ALDSVTLVGKEGVDIASTTTRLAYQDDFGNKFDRTHVDNLAGIHVKDKNGKLIVHSPKD
FT                   VTIKGAELNSAGGILVQANHIDIGTLNTKNKTDYNADMDNYYRLEQHQEVGSQLNGKGN
FT                   ITLAGEQGVVIRQGEIHSENGDVHIASNGNIRIEEGRNKERLSSASKVKHSGFLQSTTD
FT                   ITKHDHHYDLAQGSTLDGKNVVLQSNANLTVQGSNIVAENQLNARAKNIAIKEAENRVF
FT                   EQDVEKTTKSGLMSSGGFGFSIGEKKTTTETNQTKYYATGSQVGSLKGDTALIAGKHYQ
FT                   QTGSTLSSLEGDVTIGAKKVDILAADDRYESRYKQTMEQKGFTIAVNIPVVQAVQNALA
FT                   VAKQAEQVGESKHSRINAMAAANTAWSAYRAGQGLMQASQSLSQMANGNMAQGANVSVS
FT                   ITYGEQKNVQTTDIQGNTAANSAINAGGKVTVTATGAGKESDIHVVGSDVSGQQGTLLQ
FT                   AEDEINVLAAKQTHQERSQNKSAGFNAGVAVSYGSNGLAFGFTVGGNYGKGYGNGDETT
FT                   YRHSHIGDKHSQTHIMSGGDTTLRGAQVRGKGVQVHAQNLSIESLQDTMTYKGKQMNVS
FT                   GQVTVGYGFSASANFNQSKINADYASVQEQSGIYAGDEGYQINIAQHTDLKGGLITSTA
FT                   QAENQGKNQFSTGTLSYSDIQNHADYNGSAVGVGVQADINGGWDGRQVRDGSPVSRVNQ
FT                   GIGFGYDKDSQSSLTKSGINTQNLIIRDEQGQLAKTGKTIETTRGEISTNITTDSAEQH
FT                   TGKLAPNFDKERLQKELDLQREVTQKFDQTRQEVKAELYDIVDEKREKATQIRKINGGY
FT                   DTELSAQLDREATDLDEKVRWLDMGLGLLQGSAGNSKTMLGVFAGTQADRAVRSATAPK
FT                   EMWYHKKVINEKTGKVKLESRQIWSLNDLSREELASIQDTNGKVITVSNPGIFNNREDS
FT                   LSNAEKQNLNSTNSSGVIVVMNPPTGNYKGWWILSSMVSELMYVGYDQLNNKVFQGYLP
FT                   KTNSEKLNQDIYREVQNMGNGWSVDTDNHSRGGITASVALKDWVNNKEQNGIAPIRKAR
FT                   FYGTATNVQNDYADVLQKNGYTYTSADGKTYNSGAYSIVHDKDFVGNKWIPFLLGNNET
FT                   TKGDCGIFCYSHSSYFAEVPEQYQRDEDGNIKMENGKPVETENWKDYTKKWGTPKTGAD
FT                   GDINHAIPKLVNPNNPNGEKYETNPF"
     MNKRQFRVIF SKTLQPIVVV SEPVKTEGKT KSEMPQMQSA VNFLPIFAAL TPLVFRLFCA        60
     LSFVFSSSVF AETLIIKADP NAPKNQQPIV LQTANGLPQV NIQTPNDKGL SHNKYQDFNV       120
     DKKGAILNNS HKDTQTQQAG WVQSNPYLAR GEAKVILNEV TSTHPTQLKG YVEVAGRKAE       180
     VIIANPNGLH CDGCGTINAT RSTMTTGKPQ IIDGQVESIN IERGKITISG KGLDNSRVNY       240
     TDILAREAEI NAGVWAGKKL NVVTGKNTIK QADMEHGGND LQITHIDSQN LSENAPHFAL       300
     DVSELGGMYA GKIHLVGTEQ GLGVRNAGHI GASADNLVID SQGKIVNQGM ISAKGNLHVS       360
     TKKEIQNQGQ LLTEAQLSTK SSHLDNRGGK IEGRTAQINA TETVNNDRIG STGSLIQTAE       420
     KLDIHSKLVT NKNTKASQSK PPEQGIIAGV LTINGDALAN QNGAIYGMQN VQLNLSVHLD       480
     NQQGEILSLG ELQIQGDKLN MNNEHGEIAS RSNLAIYANK LESEGEIESS HNASIHLKQD       540
     LTLNNAFKVG GNLDFQTQGN FINNSVLRVG EKLSIQAHNI NNNRESELSG KNTQILSNEI       600
     INRGLIDGEK TLLKSTALSN LGTGRIYGNH LAIATPNLIN GKEDNASPTI AARERLDLAV       660
     GSLINRDHAL IFSAGEMGIG GHLNEQHHAE GKASFIDNGS ATIEALGNAY VNTARLQNHD       720
     LHLRLGENHT DERRVEYAPK NTSRRYVLID KDGNHGRFDS RNNSRSDRNS YLRLNDGTTI       780
     AANSWMHWDY NRHTITTTIE KRDPAKILIG GDLHLSGNDL ENNASTLSVG KRLLLGDEVF       840
     IKNDKNETLH STTGTSLNNI DIAGTINVTD KGHWDSFHKK KRRYGIRGRK RWAVYGTGRG       900
     DLNDIHPTSH FFFNKVDNTI GQPVDSTNTQ ITAQAEAIVP NQMNGVIINL PEQSLYQINP       960
     DAPNGYLVET DPHFTNRKQW LSSDYMLNAL RYNHENVQKR LGDGFYEQRL INEQIHQLTG      1020
     RRFLDNHQTD DEQYKALMDS GIYYAKKFNL HLGVGLTAEQ MAELTADMVW FVNKEITLPS      1080
     GKKLTVLTPQ VYLVARNLDV TSQGALISAR EIMGNINGKL TNTGTIAGRN LTALSAKNIN      1140
     NQGLVLGDSV NLLAKQKLVN LGGRIEALDS VTLVGKEGVD IASTTTRLAY QDDFGNKFDR      1200
     THVDNLAGIH VKDKNGKLIV HSPKDVTIKG AELNSAGGIL VQANHIDIGT LNTKNKTDYN      1260
     ADMDNYYRLE QHQEVGSQLN GKGNITLAGE QGVVIRQGEI HSENGDVHIA SNGNIRIEEG      1320
     RNKERLSSAS KVKHSGFLQS TTDITKHDHH YDLAQGSTLD GKNVVLQSNA NLTVQGSNIV      1380
     AENQLNARAK NIAIKEAENR VFEQDVEKTT KSGLMSSGGF GFSIGEKKTT TETNQTKYYA      1440
     TGSQVGSLKG DTALIAGKHY QQTGSTLSSL EGDVTIGAKK VDILAADDRY ESRYKQTMEQ      1500
     KGFTIAVNIP VVQAVQNALA VAKQAEQVGE SKHSRINAMA AANTAWSAYR AGQGLMQASQ      1560
     SLSQMANGNM AQGANVSVSI TYGEQKNVQT TDIQGNTAAN SAINAGGKVT VTATGAGKES      1620
     DIHVVGSDVS GQQGTLLQAE DEINVLAAKQ THQERSQNKS AGFNAGVAVS YGSNGLAFGF      1680
     TVGGNYGKGY GNGDETTYRH SHIGDKHSQT HIMSGGDTTL RGAQVRGKGV QVHAQNLSIE      1740
     SLQDTMTYKG KQMNVSGQVT VGYGFSASAN FNQSKINADY ASVQEQSGIY AGDEGYQINI      1800
     AQHTDLKGGL ITSTAQAENQ GKNQFSTGTL SYSDIQNHAD YNGSAVGVGV QADINGGWDG      1860
     RQVRDGSPVS RVNQGIGFGY DKDSQSSLTK SGINTQNLII RDEQGQLAKT GKTIETTRGE      1920
     ISTNITTDSA EQHTGKLAPN FDKERLQKEL DLQREVTQKF DQTRQEVKAE LYDIVDEKRE      1980
     KATQIRKING GYDTELSAQL DREATDLDEK VRWLDMGLGL LQGSAGNSKT MLGVFAGTQA      2040
     DRAVRSATAP KEMWYHKKVI NEKTGKVKLE SRQIWSLNDL SREELASIQD TNGKVITVSN      2100
     PGIFNNREDS LSNAEKQNLN STNSSGVIVV MNPPTGNYKG WWILSSMVSE LMYVGYDQLN      2160
     NKVFQGYLPK TNSEKLNQDI YREVQNMGNG WSVDTDNHSR GGITASVALK DWVNNKEQNG      2220
     IAPIRKARFY GTATNVQNDY ADVLQKNGYT YTSADGKTYN SGAYSIVHDK DFVGNKWIPF      2280
     LLGNNETTKG DCGIFCYSHS SYFAEVPEQY QRDEDGNIKM ENGKPVETEN WKDYTKKWGT      2340
     PKTGADGDIN HAIPKLVNPN NPNGEKYETN PF                                    2372
//

If you have problems or comments...

PBIL Back to PBIL home page