(data stored in ACNUC7421 zone)

EMBL: CP000947.PE265

CP000947.PE265       Location/Qualifiers
FT   CDS             288599..288940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nme:NMB1764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31897"
FT                   /db_xref="GOA:B0UW74"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW74"
FT                   /protein_id="ACA31897.1"
FT                   /translation="MEKNMKQILFKYFMLITCVLGLSGCGYLLSLGQLMLDGRCADWNC
FT                   SKPTPRWRKAVDDCYSRNFGVVKQQLGYKDHGEVQDSDIGQHISYQCVRHDGRYDIRKD
FT                   KQYGHLFVK"
     MEKNMKQILF KYFMLITCVL GLSGCGYLLS LGQLMLDGRC ADWNCSKPTP RWRKAVDDCY        60
     SRNFGVVKQQ LGYKDHGEVQ DSDIGQHISY QCVRHDGRYD IRKDKQYGHL FVK              113
//

If you have problems or comments...

PBIL Back to PBIL home page