(data stored in ACNUC7421 zone)

EMBL: CP000947.PE266

CP000947.PE266       Location/Qualifiers
FT   CDS             289047..292526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0270"
FT                   /product="hemagglutinin/hemolysin-related protein"
FT                   /note="KEGG: nme:NMB1768 hemagglutinin/hemolysin-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31899"
FT                   /db_xref="InterPro:IPR006914"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW75"
FT                   /protein_id="ACA31899.1"
FT                   /translation="MDNYYRLEQHQEVGSQLNGKGNITLAGEQGVVIRQGEIHSENGDV
FT                   HIASNGNIRIEEGRNKERLSSASKVKHSGFLQSTTDITKHDHHYDLAQGSTLDGKNVVL
FT                   QSNANLTVQGSNIVAENQLNARAKNIAIKEAENRVFEQDVEKTTKSGLMGSGGFGFSIG
FT                   EKKTTTETNQTKYYATGSQAGSLKGNTTLLAQEHYHQQGSTLSSLEGDVTIGAKKVDIL
FT                   AADDRYESHYKQTMEQKGFTIAVNIPVVQAVQNTLAVAKQAEQVGESKHSRINAMAAAN
FT                   TAWSAYRAGQGLMQASQSLSQMASGNMAQGANVSVSITYGEQKNVQTTDIQGNRAANSA
FT                   INAGGKVTVIATGAGKESDIHVVGSDVSGKQGTFLQAEDDINLRAAKQTHQERSQNKSA
FT                   GFNAGVAVSYGSNGLAFGFTAGGNYGKGYGNGDETTWRNSHIGDKHSQTHIMSGGDTAI
FT                   KGAQVRGKGVQVQAQNLNIESLQDTMTYKGKQMNVSGQVTVGYGFSASANFNQSKINAD
FT                   YASVQEQSGIYAGNEGYQINIAQHTDLKGGLITSTEQAEKQGKNQFSTGTLSYSDIQNH
FT                   ADYKGSRIGLSGSMAINFDTPLGKYGQAQSQKQAVNDKGEKLYIDSQGKQTTASRDSAG
FT                   NANQAKLAKGLDSLTGTTSFGFGSDRDHQRSETKSGINTTNIAIRDEQGQLKKTTKTVE
FT                   QIAAEVKTNMTTDNAESRSGKLENRFDKDELQKELDLQRTVSQDFSKNVQAANAKINQH
FT                   LDQLKTQREKGEISQSDYDTRVRSWQRGQVLLNSVASGLIAPTQSTIGIVAATASPALS
FT                   YEIGQHFKGLAKANQLTGKTEREELTVEQKAAHILAHAVLGAAAAAAGDNHALAGAISA
FT                   GGAEAATPVIGKWLYGKDKGSDLTAKEKETVTSIIGLLGAAIGTTVGNSSTNAVQGSLN
FT                   AQSAVENNSLHVDKNGVVIRNISNDDYNIYQYDYACSPVAGNNCPNLKDFDELYNSPKK
FT                   VVGQVMWQDSFTSPESGKSFGIIHFGENIEPYIYQLNDKAWGQWDITVAIKSLPGGEYD
FT                   IKSNYPSAGSYHGFLFQGKYISLRDGGNILAGMNAAVNRKTFDEFQQASGALQQGGKIG
FT                   VLLNVFTGKTYGSAPMYGELPYQYNKSKYGYDLGLERIWIKDDMKNMIPNNK"
     MDNYYRLEQH QEVGSQLNGK GNITLAGEQG VVIRQGEIHS ENGDVHIASN GNIRIEEGRN        60
     KERLSSASKV KHSGFLQSTT DITKHDHHYD LAQGSTLDGK NVVLQSNANL TVQGSNIVAE       120
     NQLNARAKNI AIKEAENRVF EQDVEKTTKS GLMGSGGFGF SIGEKKTTTE TNQTKYYATG       180
     SQAGSLKGNT TLLAQEHYHQ QGSTLSSLEG DVTIGAKKVD ILAADDRYES HYKQTMEQKG       240
     FTIAVNIPVV QAVQNTLAVA KQAEQVGESK HSRINAMAAA NTAWSAYRAG QGLMQASQSL       300
     SQMASGNMAQ GANVSVSITY GEQKNVQTTD IQGNRAANSA INAGGKVTVI ATGAGKESDI       360
     HVVGSDVSGK QGTFLQAEDD INLRAAKQTH QERSQNKSAG FNAGVAVSYG SNGLAFGFTA       420
     GGNYGKGYGN GDETTWRNSH IGDKHSQTHI MSGGDTAIKG AQVRGKGVQV QAQNLNIESL       480
     QDTMTYKGKQ MNVSGQVTVG YGFSASANFN QSKINADYAS VQEQSGIYAG NEGYQINIAQ       540
     HTDLKGGLIT STEQAEKQGK NQFSTGTLSY SDIQNHADYK GSRIGLSGSM AINFDTPLGK       600
     YGQAQSQKQA VNDKGEKLYI DSQGKQTTAS RDSAGNANQA KLAKGLDSLT GTTSFGFGSD       660
     RDHQRSETKS GINTTNIAIR DEQGQLKKTT KTVEQIAAEV KTNMTTDNAE SRSGKLENRF       720
     DKDELQKELD LQRTVSQDFS KNVQAANAKI NQHLDQLKTQ REKGEISQSD YDTRVRSWQR       780
     GQVLLNSVAS GLIAPTQSTI GIVAATASPA LSYEIGQHFK GLAKANQLTG KTEREELTVE       840
     QKAAHILAHA VLGAAAAAAG DNHALAGAIS AGGAEAATPV IGKWLYGKDK GSDLTAKEKE       900
     TVTSIIGLLG AAIGTTVGNS STNAVQGSLN AQSAVENNSL HVDKNGVVIR NISNDDYNIY       960
     QYDYACSPVA GNNCPNLKDF DELYNSPKKV VGQVMWQDSF TSPESGKSFG IIHFGENIEP      1020
     YIYQLNDKAW GQWDITVAIK SLPGGEYDIK SNYPSAGSYH GFLFQGKYIS LRDGGNILAG      1080
     MNAAVNRKTF DEFQQASGAL QQGGKIGVLL NVFTGKTYGS APMYGELPYQ YNKSKYGYDL      1140
     GLERIWIKDD MKNMIPNNK                                                   1159
//

If you have problems or comments...

PBIL Back to PBIL home page