(data stored in ACNUC7421 zone)

EMBL: CP000947.PE267

CP000947.PE267       Location/Qualifiers
FT   CDS             292546..293073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nme:NMB1502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31900"
FT                   /db_xref="GOA:B0UW76"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW76"
FT                   /protein_id="ACA31900.1"
FT                   /translation="MEFVNNFNILSLLLLIFIPIFLTIYVIYHAIHYHKTYILKMSFVL
FT                   LGLIFFSMYYIHCRYIDPQKIAHYCIDGKCISIVHLCKGCGINSPTYAKIYDGKILFRF
FT                   QTKTRNHAEFLMEDDILISKIILGNKFIIYGSLPLMYGNVDTIKVKEAAGYINEERIDY
FT                   IASRKLKFRYLY"
     MEFVNNFNIL SLLLLIFIPI FLTIYVIYHA IHYHKTYILK MSFVLLGLIF FSMYYIHCRY        60
     IDPQKIAHYC IDGKCISIVH LCKGCGINSP TYAKIYDGKI LFRFQTKTRN HAEFLMEDDI       120
     LISKIILGNK FIIYGSLPLM YGNVDTIKVK EAAGYINEER IDYIASRKLK FRYLY            175
//

If you have problems or comments...

PBIL Back to PBIL home page