(data stored in ACNUC7421 zone)

EMBL: CP000947.PE268

CP000947.PE268       Location/Qualifiers
FT   CDS             293222..294907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msu:MS1162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31901"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW77"
FT                   /protein_id="ACA31901.1"
FT                   /translation="MRQDTMTYKGKQMNVKGQVTVGYGFSASADFNQSKINADYASVQE
FT                   QSGIYAGDEGYQINIAQHTDLKGGLITSTAQAEKQGKNQFSTGTLSYSDIQNYSHHSAR
FT                   GFGLSGGVTVSGGEAPKEIGGMNLQHIGQNAQDGSSKVEYSGIAGVSSQGNWGITKGIT
FT                   TALLGQVKYKGSESGITTGSINTAHITIRHRDAQQKLTGKTVEESLQNLPKINLHQGVE
FT                   KADVETIRSDLARDLNTATEFVNNLNNQGDEIHYKMEKNEDSLFSIQKTRSDCDHISCL
FT                   DFDKDNSQELKRIIYSEELLTEEQAKLFSKVATAGMLNLTREAKVSSAVLYDKDLSSIE
FT                   DTALILNRGSAGILNEIIFTGFERFRAWVNMPAIFGASNATRAHAQIAKKLDEYNAYAE
FT                   SRGTKTYTFKNSAHSLGVSGNKNMLNWSEHIGQKYEHTDVEYLHLGGSYPSSEIDQQSR
FT                   RLFKSVKTQYHGVKGDFVYEGTPVLRNLGLGMIGNNPNATPNKANVSFLDTHTKANQNI
FT                   NNLKFVYKSEENGTKTKEWLTIEDMLKKTYTEGIRKFNEINGGR"
     MRQDTMTYKG KQMNVKGQVT VGYGFSASAD FNQSKINADY ASVQEQSGIY AGDEGYQINI        60
     AQHTDLKGGL ITSTAQAEKQ GKNQFSTGTL SYSDIQNYSH HSARGFGLSG GVTVSGGEAP       120
     KEIGGMNLQH IGQNAQDGSS KVEYSGIAGV SSQGNWGITK GITTALLGQV KYKGSESGIT       180
     TGSINTAHIT IRHRDAQQKL TGKTVEESLQ NLPKINLHQG VEKADVETIR SDLARDLNTA       240
     TEFVNNLNNQ GDEIHYKMEK NEDSLFSIQK TRSDCDHISC LDFDKDNSQE LKRIIYSEEL       300
     LTEEQAKLFS KVATAGMLNL TREAKVSSAV LYDKDLSSIE DTALILNRGS AGILNEIIFT       360
     GFERFRAWVN MPAIFGASNA TRAHAQIAKK LDEYNAYAES RGTKTYTFKN SAHSLGVSGN       420
     KNMLNWSEHI GQKYEHTDVE YLHLGGSYPS SEIDQQSRRL FKSVKTQYHG VKGDFVYEGT       480
     PVLRNLGLGM IGNNPNATPN KANVSFLDTH TKANQNINNL KFVYKSEENG TKTKEWLTIE       540
     DMLKKTYTEG IRKFNEINGG R                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page