(data stored in ACNUC7421 zone)

EMBL: CP000947.PE269

CP000947.PE269       Location/Qualifiers
FT   CDS             294885..295271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31902"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW78"
FT                   /protein_id="ACA31902.1"
FT                   /translation="MKLMGVDNMKKFVFLVFFLLSGCSAIISLYPGYDKDVMHGERFWV
FT                   KKGTNEQVSEKTYVACFHKGLQFDLNQKGFTSYSPDWDEYNVALYQSKCLHDLGYAFKE
FT                   DIFSKYCYHYQNELNCKAYRKFKY"
     MKLMGVDNMK KFVFLVFFLL SGCSAIISLY PGYDKDVMHG ERFWVKKGTN EQVSEKTYVA        60
     CFHKGLQFDL NQKGFTSYSP DWDEYNVALY QSKCLHDLGY AFKEDIFSKY CYHYQNELNC       120
     KAYRKFKY                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page