(data stored in ACNUC7421 zone)

EMBL: CP000947.PE27

CP000947.PE27        Location/Qualifiers
FT   CDS             complement(22380..22694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31898"
FT                   /db_xref="GOA:B0UUY5"
FT                   /db_xref="InterPro:IPR035333"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY5"
FT                   /protein_id="ACA31898.1"
FT                   /translation="MKKQNMPTGFSRFSWALVGFCLPVLLWPLALLISPNFIKNPNLDD
FT                   FQMRWMSIFFWAYPFILGIIARYSFKLNQRNSQLAKYVLLLSAVIFYSVLIYVCAAGLN
FT                   "
     MKKQNMPTGF SRFSWALVGF CLPVLLWPLA LLISPNFIKN PNLDDFQMRW MSIFFWAYPF        60
     ILGIIARYSF KLNQRNSQLA KYVLLLSAVI FYSVLIYVCA AGLN                        104
//

If you have problems or comments...

PBIL Back to PBIL home page