(data stored in ACNUC7421 zone)

EMBL: CP000947.PE270

CP000947.PE270       Location/Qualifiers
FT   CDS             295335..296903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0274"
FT                   /product="adhesin HecA 20-residue repeat X2"
FT                   /note="KEGG: mfa:Mfla_0483 adhesin HecA 20-residue repeat
FT                   X2"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31903"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW79"
FT                   /protein_id="ACA31903.1"
FT                   /translation="MQSYFLNISGQMTVGYGFSASANFNQSKINADYASVQEQSGIYAG
FT                   DEGYQINIAQHTDLKGGLITSTENAETENRNQFSTGTFTYSDIQNHADYKGSSIGLSGS
FT                   MAINFDTPLGKYGQVQSNKQAVNDKGEKLYIDSQGRQTTTSRDSAGNANQAKLAKGLDS
FT                   LTGTTSFGFGYDKESQSSVTKSGINTQNLIIRDEQGQVEKTGKTVEQVKAEVKTNITTD
FT                   NAESRSGKLENKFDKEKVLKELNIQVKVTQEFRKNAFSTIDAYVLPKQAELREKIKAAQ
FT                   TEEEKDELYKEIYKLQYQKRLLETTVGIIAGTPEIAITQGTLQLAATKMREETLKNSRL
FT                   FKGIKDKKTGQILRNDSYSSGYFDGVKLGGVRIDVDVICNSGMGACSKNNDGSITFNGT
FT                   NDYTLKDAIDPTQNNKAKKLYGETGGFQAVEGGWYFNGEPIFKYKLGSISDLSVESFAG
FT                   THDMSGSQIWGWYDKLGNTAPKTPMQDTSSKATTIIAIPISAPFAVADLMSADFFEVLM
FT                   KIGGQ"
     MQSYFLNISG QMTVGYGFSA SANFNQSKIN ADYASVQEQS GIYAGDEGYQ INIAQHTDLK        60
     GGLITSTENA ETENRNQFST GTFTYSDIQN HADYKGSSIG LSGSMAINFD TPLGKYGQVQ       120
     SNKQAVNDKG EKLYIDSQGR QTTTSRDSAG NANQAKLAKG LDSLTGTTSF GFGYDKESQS       180
     SVTKSGINTQ NLIIRDEQGQ VEKTGKTVEQ VKAEVKTNIT TDNAESRSGK LENKFDKEKV       240
     LKELNIQVKV TQEFRKNAFS TIDAYVLPKQ AELREKIKAA QTEEEKDELY KEIYKLQYQK       300
     RLLETTVGII AGTPEIAITQ GTLQLAATKM REETLKNSRL FKGIKDKKTG QILRNDSYSS       360
     GYFDGVKLGG VRIDVDVICN SGMGACSKNN DGSITFNGTN DYTLKDAIDP TQNNKAKKLY       420
     GETGGFQAVE GGWYFNGEPI FKYKLGSISD LSVESFAGTH DMSGSQIWGW YDKLGNTAPK       480
     TPMQDTSSKA TTIIAIPISA PFAVADLMSA DFFEVLMKIG GQ                          522
//

If you have problems or comments...

PBIL Back to PBIL home page