(data stored in ACNUC7421 zone)

EMBL: CP000947.PE271

CP000947.PE271       Location/Qualifiers
FT   CDS             296905..297255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31904"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW80"
FT                   /protein_id="ACA31904.1"
FT                   /translation="MKKAVLIFILFLLAGCSYHDGCFYSPQLVSCVDKGEVFPSISRYQ
FT                   KPYSLGRTDSNQRWKDVISCGGKYLDYDQRSVPFEKQEEFYYCMLGKGYIHLSPAKCGY
FT                   QNPKWDKGVCNF"
     MKKAVLIFIL FLLAGCSYHD GCFYSPQLVS CVDKGEVFPS ISRYQKPYSL GRTDSNQRWK        60
     DVISCGGKYL DYDQRSVPFE KQEEFYYCML GKGYIHLSPA KCGYQNPKWD KGVCNF           116
//

If you have problems or comments...

PBIL Back to PBIL home page