(data stored in ACNUC7421 zone)

EMBL: CP000947.PE272

CP000947.PE272       Location/Qualifiers
FT   CDS             297372..297707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31905"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW81"
FT                   /protein_id="ACA31905.1"
FT                   /translation="MKVFSIISVVFLIGCSFGGFKPPKLHYKWRFEDKNFETSYEYAVF
FT                   RGKEMRSCGMDPVLGESVKLKVNLCMEKKGWYLEQGPVCEEKYVWNEPECIKWRAKHSK
FT                   PDAKPWE"
     MKVFSIISVV FLIGCSFGGF KPPKLHYKWR FEDKNFETSY EYAVFRGKEM RSCGMDPVLG        60
     ESVKLKVNLC MEKKGWYLEQ GPVCEEKYVW NEPECIKWRA KHSKPDAKPW E                111
//

If you have problems or comments...

PBIL Back to PBIL home page