(data stored in ACNUC7421 zone)

EMBL: CP000947.PE273

CP000947.PE273       Location/Qualifiers
FT   CDS             298438..299547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0277"
FT                   /product="Cystathionine gamma-synthase"
FT                   /EC_number="2.5.1.48"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   hso:HS_1345 cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31906"
FT                   /db_xref="GOA:B0UW82"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW82"
FT                   /protein_id="ACA31906.1"
FT                   /translation="MTQQYALDTLLAQAGNRTDERTGAVSTPIFLSTAYAHHGIGESTG
FT                   FDYTRTKNPTRTVLEETIAKLEGGDRGFACSSGMAAIQLLMNLFASPDEWIVSSDVYGG
FT                   TYRLLDFAHKNIHGVKPVYVNTASSEEIEKAITENTKAIFVETPSNPLMEECDVAEIAK
FT                   IAKKYNLLLIVDNTFLTPVLFRPMEHGADIVIHSGTKYIAGHNDTLVGLIVAKGQEICD
FT                   RLYYIQNGAGPVLSPFDSWLTIRGMKTLALRMERHQKNAQELANFLREQPQVKDVLYPN
FT                   KGGMLSFRLQNENWVNPFLKAMKLITFAESLGGTESFITYPATQTHMDIPEVERVARGV
FT                   CNRLLRFSVGLENVEDIKADLLQAFSQLK"
     MTQQYALDTL LAQAGNRTDE RTGAVSTPIF LSTAYAHHGI GESTGFDYTR TKNPTRTVLE        60
     ETIAKLEGGD RGFACSSGMA AIQLLMNLFA SPDEWIVSSD VYGGTYRLLD FAHKNIHGVK       120
     PVYVNTASSE EIEKAITENT KAIFVETPSN PLMEECDVAE IAKIAKKYNL LLIVDNTFLT       180
     PVLFRPMEHG ADIVIHSGTK YIAGHNDTLV GLIVAKGQEI CDRLYYIQNG AGPVLSPFDS       240
     WLTIRGMKTL ALRMERHQKN AQELANFLRE QPQVKDVLYP NKGGMLSFRL QNENWVNPFL       300
     KAMKLITFAE SLGGTESFIT YPATQTHMDI PEVERVARGV CNRLLRFSVG LENVEDIKAD       360
     LLQAFSQLK                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page