(data stored in ACNUC7421 zone)

EMBL: CP000947.PE274

CP000947.PE274       Location/Qualifiers
FT   CDS             299712..300035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0278"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: hso:HS_1344 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31907"
FT                   /db_xref="GOA:B0UW83"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW83"
FT                   /protein_id="ACA31907.1"
FT                   /translation="MSEVLHTTDATFDTDVLKSDIPVLLDFWAPWCGPCRMIGPILEEL
FT                   SAELGDKVKIVKINIDENQATPAQFGVRSIPTLIFFKEGKAVATQVGALPKNQLVNFIN
FT                   QNS"
     MSEVLHTTDA TFDTDVLKSD IPVLLDFWAP WCGPCRMIGP ILEELSAELG DKVKIVKINI        60
     DENQATPAQF GVRSIPTLIF FKEGKAVATQ VGALPKNQLV NFINQNS                     107
//

If you have problems or comments...

PBIL Back to PBIL home page