(data stored in ACNUC7421 zone)

EMBL: CP000947.PE275

CP000947.PE275       Location/Qualifiers
FT   CDS             complement(300153..300848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0279"
FT                   /product="Chromosomal replication initiator DnaA"
FT                   /note="PFAM: Chromosomal replication initiator DnaA; KEGG:
FT                   hso:HS_1343 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31908"
FT                   /db_xref="GOA:B0UW84"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR017788"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW84"
FT                   /protein_id="ACA31908.1"
FT                   /translation="MSQQLPLPIHQIDDDTLENFCSDNNLLLLGSLRKNFIQLYQPFFY
FT                   IFGGKSTGKTHLLKACSNYFLASQRNAIYIPLSKAQYFSPEVLENLEQQELVCLDDFHA
FT                   IIGNHEWELAIFDLMNRIKESGSTLLLISANQSPVNLNISLPDLASRLSWGEIYQLNPL
FT                   NEQQKVEVIKRNAHQRGIELPDDTANFLLKRLDRDIKSLFDTLTLLDKASLQAQRKLTI
FT                   PFVKEILNL"
     MSQQLPLPIH QIDDDTLENF CSDNNLLLLG SLRKNFIQLY QPFFYIFGGK STGKTHLLKA        60
     CSNYFLASQR NAIYIPLSKA QYFSPEVLEN LEQQELVCLD DFHAIIGNHE WELAIFDLMN       120
     RIKESGSTLL LISANQSPVN LNISLPDLAS RLSWGEIYQL NPLNEQQKVE VIKRNAHQRG       180
     IELPDDTANF LLKRLDRDIK SLFDTLTLLD KASLQAQRKL TIPFVKEILN L                231
//

If you have problems or comments...

PBIL Back to PBIL home page