(data stored in ACNUC7421 zone)

EMBL: CP000947.PE278

CP000947.PE278       Location/Qualifiers
FT   CDS             complement(303044..303871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0282"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   hso:HS_1340 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31912"
FT                   /db_xref="GOA:B0UW87"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW87"
FT                   /protein_id="ACA31912.1"
FT                   /translation="MCQLLGMNCNTPTDIVFSFEGFRRRAGLTNCHSDGFGIAFFEGKG
FT                   IRVFRDNRPGHSSPIADCIKQYNIKSLNVVAHIRKATQGEVNIENTHPFIRELWGENWV
FT                   FAHNGNLNSLPDMTESLFQPIGSTDSETAFCYMLSQLKKRFPKKPNEQDMFSAIQKLTQ
FT                   ELTRRGTFNFILSNGEWMMAHCSTNLHYLTRKAPFGKAQRIDDDNIIDFRDYAKETDKV
FT                   TIITTFPLTKDEHWNKMESGGFVMFKEGDKVAEILGIESEIIDDGTLGMQQFA"
     MCQLLGMNCN TPTDIVFSFE GFRRRAGLTN CHSDGFGIAF FEGKGIRVFR DNRPGHSSPI        60
     ADCIKQYNIK SLNVVAHIRK ATQGEVNIEN THPFIRELWG ENWVFAHNGN LNSLPDMTES       120
     LFQPIGSTDS ETAFCYMLSQ LKKRFPKKPN EQDMFSAIQK LTQELTRRGT FNFILSNGEW       180
     MMAHCSTNLH YLTRKAPFGK AQRIDDDNII DFRDYAKETD KVTIITTFPL TKDEHWNKME       240
     SGGFVMFKEG DKVAEILGIE SEIIDDGTLG MQQFA                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page