(data stored in ACNUC7421 zone)

EMBL: CP000947.PE28

CP000947.PE28        Location/Qualifiers
FT   CDS             22738..23601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0028"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: hso:HS_0162
FT                   GlpG protein, rhomboid family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31909"
FT                   /db_xref="GOA:B0UUY6"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY6"
FT                   /protein_id="ACA31909.1"
FT                   /translation="MKLLFGSERENFIIWFRDYIRAKYLLELTIQNYIDEKYNRSVRGV
FT                   FIEENHPLLTQLEQEKILFLQDPFNPCYQQAAWEAGDTHSIQYKKTSWVAIWKISSKWF
FT                   QQGKITLFITALCTLIYVLQNLGFEQGIFYFAHYPANPAQQTEIWRYISHSLVHLSPLH
FT                   FLFNLSWFWLFGGAIERQLNAKKLLLLFFVSSILTGVVQNYFSDYRFFGLSGVVYAVLG
FT                   YVFILDKFHYAKFALPSGFFLMLIMGIALGFISPLVGIYMGNSAHISGLLCGILLGLWQ
FT                   VKKREF"
     MKLLFGSERE NFIIWFRDYI RAKYLLELTI QNYIDEKYNR SVRGVFIEEN HPLLTQLEQE        60
     KILFLQDPFN PCYQQAAWEA GDTHSIQYKK TSWVAIWKIS SKWFQQGKIT LFITALCTLI       120
     YVLQNLGFEQ GIFYFAHYPA NPAQQTEIWR YISHSLVHLS PLHFLFNLSW FWLFGGAIER       180
     QLNAKKLLLL FFVSSILTGV VQNYFSDYRF FGLSGVVYAV LGYVFILDKF HYAKFALPSG       240
     FFLMLIMGIA LGFISPLVGI YMGNSAHISG LLCGILLGLW QVKKREF                     287
//

If you have problems or comments...

PBIL Back to PBIL home page