(data stored in ACNUC7421 zone)

EMBL: CP000947.PE281

CP000947.PE281       Location/Qualifiers
FT   CDS             complement(307235..309025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0285"
FT                   /product="Beta-glucuronidase"
FT                   /EC_number="3.2.1.31"
FT                   /note="PFAM: glycoside hydrolase family 2 immunoglobulin
FT                   domain protein beta-sandwich; glycoside hydrolase family 2
FT                   TIM barrel; glycoside hydrolase family 2 sugar binding;
FT                   KEGG: hso:HS_1330 beta-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31915"
FT                   /db_xref="GOA:B0UW90"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW90"
FT                   /protein_id="ACA31915.1"
FT                   /translation="MLYPTLTKTRSLYDLSGLWQFKLGEHNPEKDLSPEEVMVVPTSFN
FT                   DVVVDKDKRNYIGDFWYERWVDIPKLAENDELVLRFGSVTHNAKIYVNGRELASHKGGF
FT                   TPFEVIIPEELYQENQIKISVCANNILDYTTLPVGNYIEETQEDGSIKKVVKENFDFFN
FT                   YAGIHRPVKLMVRPKIHISDVTIVSELSDDLKTAKLSIAVETSKAVDTIQVTILDEDRQ
FT                   VVAQSSNGHITLEQVRLWEVLDAYLYTAHIELLVDGKVVDTYDEPFGVRSVHVADGQFF
FT                   VNQKPVYFKGFGKHEDTFINGRGLNEAANLMDMNLLKEIGANSFRTSHYPYSEEMMRLA
FT                   DRMGVLVIDEIPAVGLFQNFTASLDLNPKDNGTWSAMKTREAHEQAIQELVKRDKNHPS
FT                   VVMWVVANEPASHEAGAHDYFKPLVALYKELDPQKRPVTLVNILLATPERDEVMDLVDV
FT                   ISLNRYYAWYVDHGDLAKGEAGLRQELLKWQSKFPDKPILMTEYGADTLPGLHSMWDIP
FT                   YTEEFQCDFYAMSHSVFDSIPNLVGEQVWNFADFETNLMIYRIQGNHKGLFSRNRQPKQ
FT                   VVKEFKKRWTAIPNYNYKKK"
     MLYPTLTKTR SLYDLSGLWQ FKLGEHNPEK DLSPEEVMVV PTSFNDVVVD KDKRNYIGDF        60
     WYERWVDIPK LAENDELVLR FGSVTHNAKI YVNGRELASH KGGFTPFEVI IPEELYQENQ       120
     IKISVCANNI LDYTTLPVGN YIEETQEDGS IKKVVKENFD FFNYAGIHRP VKLMVRPKIH       180
     ISDVTIVSEL SDDLKTAKLS IAVETSKAVD TIQVTILDED RQVVAQSSNG HITLEQVRLW       240
     EVLDAYLYTA HIELLVDGKV VDTYDEPFGV RSVHVADGQF FVNQKPVYFK GFGKHEDTFI       300
     NGRGLNEAAN LMDMNLLKEI GANSFRTSHY PYSEEMMRLA DRMGVLVIDE IPAVGLFQNF       360
     TASLDLNPKD NGTWSAMKTR EAHEQAIQEL VKRDKNHPSV VMWVVANEPA SHEAGAHDYF       420
     KPLVALYKEL DPQKRPVTLV NILLATPERD EVMDLVDVIS LNRYYAWYVD HGDLAKGEAG       480
     LRQELLKWQS KFPDKPILMT EYGADTLPGL HSMWDIPYTE EFQCDFYAMS HSVFDSIPNL       540
     VGEQVWNFAD FETNLMIYRI QGNHKGLFSR NRQPKQVVKE FKKRWTAIPN YNYKKK           596
//

If you have problems or comments...

PBIL Back to PBIL home page