(data stored in ACNUC7421 zone)

EMBL: CP000947.PE282

CP000947.PE282       Location/Qualifiers
FT   CDS             complement(309047..310075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0286"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: hso:HS_1329
FT                   2-keto-3-deoxygluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31916"
FT                   /db_xref="GOA:B0UW91"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW91"
FT                   /protein_id="ACA31916.1"
FT                   /translation="MKTVVSLGEILLRLSPPQYQTLTLTTSLECQFGGSELNVLSTLAQ
FT                   LGHNVSLISAIPDNDLGRMTKNFLFSRQINQDYILEKGQRLGIYYYQKGFSLRASRVTY
FT                   DRKHSAFWESQLSDYDLESVFKGADWFHVSGITPALNDNLYSLTHYLMTKAKAEGLTVS
FT                   FDLNFRASLWNSFQEARELLSPLAALADVCIGIEPLSLSGDGQGDLKDQLGLTRPYEDQ
FT                   ELLKSILDKLAKTYSVKSFAFTQREMGHTNEYLLKGYLYQDGHLYQTDKSGIQVLDRVG
FT                   TGDAFTAGIIHGMLKKESPEKSLAIAMASFKFKHTIEGDINVISQADIDQLLDETSHEI
FT                   KR"
     MKTVVSLGEI LLRLSPPQYQ TLTLTTSLEC QFGGSELNVL STLAQLGHNV SLISAIPDND        60
     LGRMTKNFLF SRQINQDYIL EKGQRLGIYY YQKGFSLRAS RVTYDRKHSA FWESQLSDYD       120
     LESVFKGADW FHVSGITPAL NDNLYSLTHY LMTKAKAEGL TVSFDLNFRA SLWNSFQEAR       180
     ELLSPLAALA DVCIGIEPLS LSGDGQGDLK DQLGLTRPYE DQELLKSILD KLAKTYSVKS       240
     FAFTQREMGH TNEYLLKGYL YQDGHLYQTD KSGIQVLDRV GTGDAFTAGI IHGMLKKESP       300
     EKSLAIAMAS FKFKHTIEGD INVISQADID QLLDETSHEI KR                          342
//

If you have problems or comments...

PBIL Back to PBIL home page