(data stored in ACNUC7421 zone)

EMBL: CP000947.PE285

CP000947.PE285       Location/Qualifiers
FT   CDS             313439..313972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0289"
FT                   /product="protein of unknown function DUF615"
FT                   /note="PFAM: protein of unknown function DUF615; KEGG:
FT                   hso:HS_1326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31919"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW94"
FT                   /protein_id="ACA31919.1"
FT                   /translation="MAKCKEEVFNWEDEEQEEIIWVSKSEIKRDAEALKKLGEKLVNLT
FT                   KTNLDKIPLDTGLRDAVELAQRLQKEALRRQIQYIGKLLRAIDPEPIQEALNKIENKHQ
FT                   QQQAKLHKLELLRDELVQKGNSAFTELLIQYPHADRQHLHNLIRSAQKEREQNKPPKSY
FT                   REIFQYLKDLILED"
     MAKCKEEVFN WEDEEQEEII WVSKSEIKRD AEALKKLGEK LVNLTKTNLD KIPLDTGLRD        60
     AVELAQRLQK EALRRQIQYI GKLLRAIDPE PIQEALNKIE NKHQQQQAKL HKLELLRDEL       120
     VQKGNSAFTE LLIQYPHADR QHLHNLIRSA QKEREQNKPP KSYREIFQYL KDLILED          177
//

If you have problems or comments...

PBIL Back to PBIL home page