(data stored in ACNUC7421 zone)

EMBL: CP000947.PE286

CP000947.PE286       Location/Qualifiers
FT   CDS             314103..315638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0290"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; Miro domain protein;
FT                   SMART: AAA ATPase; KEGG: hso:HS_1325 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31921"
FT                   /db_xref="GOA:B0UW95"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW95"
FT                   /protein_id="ACA31921.1"
FT                   /translation="MTTPVVALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRKYGQ
FT                   AHFNGYDFIVIDTGGIDGTEEGVEEKMAEQSLLAIEEADIVLFLVDARAGLTSADVGIA
FT                   QYLRKRQNKTTVLVANKTDGIDADSHCAEFYQLGLGEIEKIAASQGRGISALMEKVLPP
FT                   VADKLSLANAEEHSESAVENSDESAEEWEKDFNFNSEEDIQLLDEALVEEQEESEDKNI
FT                   KIAIVGRPNVGKSTLTNRILGEDRVVVYDLPGTTRDSIYIPMERDGQQYTLIDTAGVRK
FT                   RGKVHLTVEKFSVIKTLQAIQDANVILLTIDARQGISDQDLSLLGFILNTGRSLVIVVN
FT                   KWDGLNQDIKDQVKSELDRRLDFIDFARVHFISALHGSGVGNLFDSIKEAYACATKKMT
FT                   TSLLTRILQMATDEHQPPMIGGRRIKLKYAHPGGYNPPIIVVHGNQIEGLPDSYKRYLS
FT                   NYYRRSLKIIGSPIRLLFQEGNNPFAGRRNKLTPNQLRKRKRLMKFIKKSKQR"
     MTTPVVALVG RPNVGKSTLF NRLTRTRDAL VADFPGLTRD RKYGQAHFNG YDFIVIDTGG        60
     IDGTEEGVEE KMAEQSLLAI EEADIVLFLV DARAGLTSAD VGIAQYLRKR QNKTTVLVAN       120
     KTDGIDADSH CAEFYQLGLG EIEKIAASQG RGISALMEKV LPPVADKLSL ANAEEHSESA       180
     VENSDESAEE WEKDFNFNSE EDIQLLDEAL VEEQEESEDK NIKIAIVGRP NVGKSTLTNR       240
     ILGEDRVVVY DLPGTTRDSI YIPMERDGQQ YTLIDTAGVR KRGKVHLTVE KFSVIKTLQA       300
     IQDANVILLT IDARQGISDQ DLSLLGFILN TGRSLVIVVN KWDGLNQDIK DQVKSELDRR       360
     LDFIDFARVH FISALHGSGV GNLFDSIKEA YACATKKMTT SLLTRILQMA TDEHQPPMIG       420
     GRRIKLKYAH PGGYNPPIIV VHGNQIEGLP DSYKRYLSNY YRRSLKIIGS PIRLLFQEGN       480
     NPFAGRRNKL TPNQLRKRKR LMKFIKKSKQ R                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page