(data stored in ACNUC7421 zone)

EMBL: CP000947.PE29

CP000947.PE29        Location/Qualifiers
FT   CDS             23818..24342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0029"
FT                   /product="protein of unknown function DUF177"
FT                   /note="PFAM: protein of unknown function DUF177; KEGG:
FT                   hso:HS_0163 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31920"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="InterPro:IPR039255"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY7"
FT                   /protein_id="ACA31920.1"
FT                   /translation="MQKVKLPLTVDPIKDAQRRLDYQGCYVSNQVTRLAESVVKVLSDV
FT                   QVTLSFFVDPQKLTVMKGRASVDVELECQRCGCPFSQSLECEFSYSPVSDLGKINELPE
FT                   IYEPIELNEFGEIDLIGTVEDELIVALPIVPMHSSEHCEVSVAEQVFGELPEELAKKPN
FT                   PFAVLASLKKK"
     MQKVKLPLTV DPIKDAQRRL DYQGCYVSNQ VTRLAESVVK VLSDVQVTLS FFVDPQKLTV        60
     MKGRASVDVE LECQRCGCPF SQSLECEFSY SPVSDLGKIN ELPEIYEPIE LNEFGEIDLI       120
     GTVEDELIVA LPIVPMHSSE HCEVSVAEQV FGELPEELAK KPNPFAVLAS LKKK             174
//

If you have problems or comments...

PBIL Back to PBIL home page