(data stored in ACNUC7421 zone)

EMBL: CP000947.PE3

CP000947.PE3         Location/Qualifiers
FT   CDS             2762..3838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: hso:HS_0138 DNA replication
FT                   and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31931"
FT                   /db_xref="GOA:B0UUM0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUM0"
FT                   /protein_id="ACA31931.1"
FT                   /translation="MAISRLIINHFRNLTAIDLEFERGFNFIIGNNGSGKTSLLEAIFY
FT                   LGHGRSFKSAVANRIISYQQPHFILHGKIQEQQHQWSVGLQKQRQGNTLMKINGEDAKK
FT                   ISDLAHLLPMQLITPEGLTLLNGGPSYRRAYLDWGLFHHNASFYNAWSSLNRLLKQRNS
FT                   ALQQVCSYEKLKIWDRELTKLAYQVSYWREAYAEALRSEIEKTCQLFLPELEISVSFHQ
FT                   GWDKNMDYADLLQQNFERDRALGYTFSGPQKADFRFKANGLPVEDILSRGQLKLLMCAL
FT                   RLAQGEHLMQQKKRHCIFLLDDFASELDQYKRTLLAERLQKNGSQVFVTAITREQLQQI
FT                   QPEKHRTFYLENGRIKDL"
     MAISRLIINH FRNLTAIDLE FERGFNFIIG NNGSGKTSLL EAIFYLGHGR SFKSAVANRI        60
     ISYQQPHFIL HGKIQEQQHQ WSVGLQKQRQ GNTLMKINGE DAKKISDLAH LLPMQLITPE       120
     GLTLLNGGPS YRRAYLDWGL FHHNASFYNA WSSLNRLLKQ RNSALQQVCS YEKLKIWDRE       180
     LTKLAYQVSY WREAYAEALR SEIEKTCQLF LPELEISVSF HQGWDKNMDY ADLLQQNFER       240
     DRALGYTFSG PQKADFRFKA NGLPVEDILS RGQLKLLMCA LRLAQGEHLM QQKKRHCIFL       300
     LDDFASELDQ YKRTLLAERL QKNGSQVFVT AITREQLQQI QPEKHRTFYL ENGRIKDL         358
//

If you have problems or comments...

PBIL Back to PBIL home page