(data stored in ACNUC7421 zone)

EMBL: CP000947.PE31

CP000947.PE31        Location/Qualifiers
FT   CDS             24651..24929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0031"
FT                   /product="putative fatty acid/phospholipid synthesis
FT                   protein"
FT                   /note="KEGG: hso:HS_0164 possible fatty acid/phospholipid
FT                   synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31943"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY9"
FT                   /protein_id="ACA31943.1"
FT                   /translation="MLSLLFANNQQNFPLRQRFPIDSQNYLAVCHCSHVIENNQGLVHT
FT                   LVHIFVEYQLGLFYLYAALLNIGIEETKEYKEYKAIRDMALQSSKKG"
     MLSLLFANNQ QNFPLRQRFP IDSQNYLAVC HCSHVIENNQ GLVHTLVHIF VEYQLGLFYL        60
     YAALLNIGIE ETKEYKEYKA IRDMALQSSK KG                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page