(data stored in ACNUC7421 zone)

EMBL: CP000947.PE32

CP000947.PE32        Location/Qualifiers
FT   CDS             24982..25932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0032"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) synthase
FT                   III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase
FT                   III domain protein; 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III; KEGG: hso:HS_0165
FT                   3-oxoacyl-[acyl-carrier-protein] synthase
FT                   (beta-ketoacyl-ACP synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31952"
FT                   /db_xref="GOA:B0UUZ0"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ0"
FT                   /protein_id="ACA31952.1"
FT                   /translation="MYSRILATGSYIPANIRTNADLEKMVETSDEWITTRSGIKERRIA
FT                   GENETVATMGFEAAKNALQLANICPNDIDLVLVATTSHSYAYPSAACQIQGMLDIDDAI
FT                   SFDLAAACTGFIYALSVADQFIKTGKVKKALVIGADINSRKLDETDRSTVILFGDGAGA
FT                   VILESSDIEGIISTHLHASLDKSNALILPQTQQGEVQSGYIQMQGNATFKLAVRELSNV
FT                   VEETLRDNHLDKADLDWLVPHQANLRIITATAEKLNMSLDQVVITLDKYGNTSAATVPV
FT                   ALDEAVRDGRIKRGQLLLLEAFGGGWTWGSALVRF"
     MYSRILATGS YIPANIRTNA DLEKMVETSD EWITTRSGIK ERRIAGENET VATMGFEAAK        60
     NALQLANICP NDIDLVLVAT TSHSYAYPSA ACQIQGMLDI DDAISFDLAA ACTGFIYALS       120
     VADQFIKTGK VKKALVIGAD INSRKLDETD RSTVILFGDG AGAVILESSD IEGIISTHLH       180
     ASLDKSNALI LPQTQQGEVQ SGYIQMQGNA TFKLAVRELS NVVEETLRDN HLDKADLDWL       240
     VPHQANLRII TATAEKLNMS LDQVVITLDK YGNTSAATVP VALDEAVRDG RIKRGQLLLL       300
     EAFGGGWTWG SALVRF                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page