(data stored in ACNUC7421 zone)

EMBL: CP000947.PE33

CP000947.PE33        Location/Qualifiers
FT   CDS             25976..26914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0033"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase; KEGG: hso:HS_0166
FT                   [acyl-carrier protein] S-malonyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31963"
FT                   /db_xref="GOA:B0UUZ1"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUZ1"
FT                   /protein_id="ACA31963.1"
FT                   /translation="MKKFAMVFPGQGSQAVGMLAELATEYPIVEETFQQASSVLGYDLW
FT                   QLVQQGPAEELNKTWQTQPALLAASVAIYRVWQQKYPYLKPEVMAGHSLGEYSALVCAG
FT                   VIDFQDGIKLVQLRGKLMQQAVPEGTGAMYAIIGLDNESIVQACKASEQGEIVSAVNFN
FT                   SPGQVVIAGAKVAVERAAVACKEAGAKRALPLAVSVPSHCALMKPAAEELAVALEKMTF
FT                   SIPQIPVINNVDVKAENETTKIRTALVRQLYSPVRWTEIVENMAREGIELLFEMGPNKV
FT                   LTGLTSRIAKELNAKAVNDLSSLNTVEESLD"
     MKKFAMVFPG QGSQAVGMLA ELATEYPIVE ETFQQASSVL GYDLWQLVQQ GPAEELNKTW        60
     QTQPALLAAS VAIYRVWQQK YPYLKPEVMA GHSLGEYSAL VCAGVIDFQD GIKLVQLRGK       120
     LMQQAVPEGT GAMYAIIGLD NESIVQACKA SEQGEIVSAV NFNSPGQVVI AGAKVAVERA       180
     AVACKEAGAK RALPLAVSVP SHCALMKPAA EELAVALEKM TFSIPQIPVI NNVDVKAENE       240
     TTKIRTALVR QLYSPVRWTE IVENMAREGI ELLFEMGPNK VLTGLTSRIA KELNAKAVND       300
     LSSLNTVEES LD                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page