(data stored in ACNUC7421 zone)

EMBL: CP000947.PE35

CP000947.PE35        Location/Qualifiers
FT   CDS             27948..28178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0035"
FT                   /product="acyl carrier protein"
FT                   /note="TIGRFAM: acyl carrier protein; PFAM:
FT                   phosphopantetheine-binding; KEGG: hso:HS_0168 acyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31985"
FT                   /db_xref="GOA:B0UUZ3"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ3"
FT                   /protein_id="ACA31985.1"
FT                   /translation="MSIEERVKKIIVEQLGVKEDDVKPEASFIEDLGADSLDTVELVMA
FT                   LEEEFDIEIPDEEAEKITTVQSAIDYVQNNQ"
     MSIEERVKKI IVEQLGVKED DVKPEASFIE DLGADSLDTV ELVMALEEEF DIEIPDEEAE        60
     KITTVQSAID YVQNNQ                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page