(data stored in ACNUC7421 zone)

EMBL: CP000947.PE36

CP000947.PE36        Location/Qualifiers
FT   CDS             28327..28755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0036"
FT                   /product="ribosomal protein L11"
FT                   /note="PFAM: ribosomal protein L11; KEGG: hso:HS_0169 50S
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31996"
FT                   /db_xref="GOA:B0UUZ4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ4"
FT                   /protein_id="ACA31996.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAR
FT                   TESLEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSSKPNKDKVGKVTLD
FT                   QIRQIAETKAADMTGATIETKMKSIEGTARSMGLVVEG"
     MAKKVQAYVK LQVAAGMANP SPPVGPALGQ QGVNIMEFCK AFNARTESLE KGLPIPVVIT        60
     VYADRSFTFV TKTPPAAVLL KKAAGIKSGS SKPNKDKVGK VTLDQIRQIA ETKAADMTGA       120
     TIETKMKSIE GTARSMGLVV EG                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page