(data stored in ACNUC7421 zone)

EMBL: CP000947.PE37

CP000947.PE37        Location/Qualifiers
FT   CDS             28760..29449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0037"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1; KEGG: hso:HS_0170 50S
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32007"
FT                   /db_xref="GOA:B0UUZ5"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ5"
FT                   /protein_id="ACA32007.1"
FT                   /translation="MAKLTKRMKAIKAGVDSTKQYEINEAITVLKQFTSTKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANVDSAKAAGADLVGMEDLAEQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPNVAEAVKNAKSGQIRY
FT                   RNDKNGIIHTTIGKANFSAEQLKENLQALLAALTKAKPATAKGIFIRKVSVSTTQGAGV
FT                   AVDQSSL"
     MAKLTKRMKA IKAGVDSTKQ YEINEAITVL KQFTSTKFVE SVDVAVNLGI DARKSDQNVR        60
     GATVLPHGTG RSVRVAVFTQ GANVDSAKAA GADLVGMEDL AEQIKKGEMN FDVVIASPDA       120
     MRVVGQLGQI LGPRGLMPNP KVGTVTPNVA EAVKNAKSGQ IRYRNDKNGI IHTTIGKANF       180
     SAEQLKENLQ ALLAALTKAK PATAKGIFIR KVSVSTTQGA GVAVDQSSL                   229
//

If you have problems or comments...

PBIL Back to PBIL home page