(data stored in ACNUC7421 zone)

EMBL: CP000947.PE38

CP000947.PE38        Location/Qualifiers
FT   CDS             29733..30224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0038"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: hso:HS_0171 50S
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32018"
FT                   /db_xref="GOA:B0UUZ6"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ6"
FT                   /protein_id="ACA32018.1"
FT                   /translation="MALNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVDKMTELRKAA
FT                   REAGVSMRVVRNTLLRRAVEGTDFECLTDTFVGPTLIAFSNEHPGAAARLFKDFAKAND
FT                   KFEIKGAAFEGKIQNVEFLATLPTYEEAIARLMGTMKEAAAGKLARTLAAYRDKLQEAA
FT                   "
     MALNLQDKQA IVAEVNEAAK GALSAVIADS RGVTVDKMTE LRKAAREAGV SMRVVRNTLL        60
     RRAVEGTDFE CLTDTFVGPT LIAFSNEHPG AAARLFKDFA KANDKFEIKG AAFEGKIQNV       120
     EFLATLPTYE EAIARLMGTM KEAAAGKLAR TLAAYRDKLQ EAA                         163
//

If you have problems or comments...

PBIL Back to PBIL home page