(data stored in ACNUC7421 zone)

EMBL: CP000947.PE39

CP000947.PE39        Location/Qualifiers
FT   CDS             30276..30644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0039"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: hso:HS_0172 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32029"
FT                   /db_xref="GOA:B0UUZ7"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ7"
FT                   /protein_id="ACA32029.1"
FT                   /translation="MSLTNEQIIEAIASKTVTEIVELISAMEEKFGVSAAAAAVAVAAG
FT                   PAEVAEEKTEFDVVLAEAGANKVAVIKAVRGATGLGLKEAKDLVESAPANLKEGISKAE
FT                   AEALKKELEEAGAKVEIK"
     MSLTNEQIIE AIASKTVTEI VELISAMEEK FGVSAAAAAV AVAAGPAEVA EEKTEFDVVL        60
     AEAGANKVAV IKAVRGATGL GLKEAKDLVE SAPANLKEGI SKAEAEALKK ELEEAGAKVE       120
     IK                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page